A2294
Activator protein 2 (AP-2/TFAP2A) Rabbit monoclonal antibody
Size
POA
- SKU:
- A2294
- Additional Names:
- Activator protein 2 (AP-2/TFAP2A)|AP-2|AP-2alpha|AP2TF|BOFS|TFAP2
- Application:
- ELISA, WB
- Molecular Weight:
- 48kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- NADFQPPYFPPPYQPIYPQSQDPYSHVNDPYSLNPLHAQPQPQHPGWPGQRQSQESGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGDLSIH
- Uniprot:
- P05549
- Synonyms:
- activating enhancer-binding protein 2-alpha;activator protein 2;AP-2;AP-2 transcription factor;AP-2alpha;AP2TF;BOFS;TFAP2;transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha);transcription factor AP-2-alpha
- Extra Details:
- The protein encoded by this gene is a transcription factor that binds the consensus sequence 5'-GCCNNNGGC-3'. The encoded protein functions as either a homodimer or as a heterodimer with similar family members. This protein activates the transcription of some genes while inhibiting the transcription of others. Defects in this gene are a cause of branchiooculofacial syndrome (BOFS). Three transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice