[KD Validated] COX IV Rabbit polyclonal antibody

Size

POA

SKU:: A22871
Additional Names:: [KD Validated] COX IV|COX IV-1|COX4|COX4-1|COXIV|COXIV-1|MC4DN16
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 17kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: AHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSN
Uniprot:: P13073
Synonyms:: COX IV-1;COX4;COX4-1;COXIV;COXIV-1;cytochrome c oxidase polypeptide IV;cytochrome c oxidase subunit 4 isoform 1, mitochondrial;cytochrome c oxidase subunit IV;Cytochrome c oxidase subunit IV isoform 1;MC4DN16
Extra Details:: Cytochrome c oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. This gene encodes the nuclear-encoded subunit IV isoform 1 of the human mitochondrial respiratory chain enzyme. It is located at the 3' of the NOC4 (neighbor of COX4) gene in a head-to-head orientation, and shares a promoter with it. Pseudogenes related to this gene are located on chromosomes 13 and 14. Alternative splicing results in multiple transcript variants encoding different isoforms.

Shipping Conditions:: Blue Ice