A22868
Bcl9 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A22868
- Additional Names:
- Bcl9|LGS
- Application:
- ELISA, WB
- Molecular Weight:
- 149kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequence:
- MHSSNPKVRSSPSGNTQSSPKSKQEVMVRPPTVMSPSGNPQLDSKFSNQGKQGGSASQSQPSPCDSKSGGHTPKALPGPGGSMGLKNGAGNGAKGKGKRE
- Uniprot:
- O00512
- Synonyms:
- B cell CLL/lymphoma 9;B-cell CLL/lymphoma 9 protein;B-cell lymphoma 9 protein;bcl-9;LGS;protein legless homolog
- Extra Details:
- BCL9 is associated with B-cell acute lymphoblastic leukemia. It may be a target of translocation in B-cell malignancies with abnormalities of 1q21. Its function is unknown. The overexpression of BCL9 may be of pathogenic significance in B-cell malignancies.
- Shipping Conditions:
- Blue Ice