A22853
XCP1 Rabbit polyclonal antibody

Size
POA
- SKU:
- A22853
- Additional Names:
- Cysteine protease5|GRMZM2G066326|IDP105|XCP1
- Application:
- ELISA, WB
- Molecular Weight:
- 41kda
- Species Reactivity:
- Plant
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Plant
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- EVPASVDWRKKGAVTEVKNQGQCGSCWAFSTVAAVEGINQIVTGNLTSLSEQQLVDCSTDGNNGCSGGVMDNAFSFIATGAGLRSEEAYPYLMEEGDCDDRARDGEVLVTISGYEDVPANDEQALVKALAHQPVSVAIEASGRHFQFYSGGVFDGPCGSELDHGVAAVGYGSSKGQDYIIVKNSWGTHWGEKGYIRMKRGTGKPEGLCGINKMASYPTKDH
- Synonyms:
- Cysteine protease XCP2;cysteine protease5;GRMZM2G066326;IDP105;nPZA01509.1;PCO132946;PCO132946(479);PZA01509;xylem cysteine proteinase 2;ZEAMMB73_Zm00001d035689
- Extra Details:
- XCP1 is a xylem-specific papain-like cysteine peptidase in Arabidopsis. Results from confocal microscopy and biochemical subcellular fractionation indicated that XCP1 was localized in the vacuole. Ectopic expression of XCP1 resulted in a reduction in plant size in some lines and early leaf senescence, as indicated by early loss of leaf chlorophyll. Reduced plant size was correlated with higher levels of XCP1, as shown by immunoblot and peptidase activity gel analyses. The XCP1 prodomain exhibits exceptionally high similarity (greater than 80%) to the prodomains of papain and other papain-like enzymes isolated from papaya (Carica papaya) laticifers when compared with all other reported papain-like enzymes. The XCP1 and papain to perform common functions as catalysts of autolytic processing following cell death due to programmed suicide or to wounding is discussed.
- Shipping Conditions:
- Blue Ice

