[KO Validated] EDF1 Rabbit polyclonal antibody

Size

POA

SKU:: A2283
Additional Names:: CFAP280|EDF-1|F1|MBF1
Application:: ELISA, WB, IHC-P
Molecular Weight:: 16kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHHDRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPRAK
Uniprot:: O60869
Synonyms:: CFAP280;EDF-1;endothelial differentiation-related factor 1;MBF1;multiprotein bridging factor 1;Multiprotein-bridging factor 1
Extra Details:: This gene encodes a protein that may regulate endothelial cell differentiation, lipid metabolism, and hormone-induced cardiomyocyte hypertrophy. The encoded protein has also been found to act as a transcriptional coactivator by interconnecting the general transcription factor TATA element-binding protein (TBP) and gene-specific activators. Alternate splicing results in multiple transcript variants.