SMURF2 Rabbit monoclonal antibody

Size

POA

SKU:: A2278
Additional Names:: E3 ubiquitin-protein ligase SMURF2|SMURF2
Application:: ELISA, WB, IHC-P, IP
Molecular Weight:: 86kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: PLSCFVDENTPISGTNGATCGQSSDPRLAERRVRSQRHRNYMSRTHLHTPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDPRVPRDLSN
Uniprot:: Q9HAU4
Synonyms:: E3 ubiquitin ligase SMURF2;E3 ubiquitin-protein ligase SMURF2;HECT-type E3 ubiquitin transferase SMURF2;hSMURF2;SMAD ubiquitination regulatory factor 2;SMAD-specific E3 ubiquitin-protein ligase 2
Extra Details:: Enables SMAD binding activity; identical protein binding activity; and ubiquitin-protein transferase activity. Involved in negative regulation of transforming growth factor beta receptor signaling pathway; positive regulation of trophoblast cell migration; and ubiquitin-dependent SMAD protein catabolic process. Located in nuclear speck. Part of ubiquitin ligase complex.