TAP1 Rabbit monoclonal antibody

Size

POA

SKU:: A22769
Additional Names:: ABC17|ABCB2|APT1|D6S114E|PSF-1|PSF1|RING4|TAP1|TAP1*0102N|TAP1N
Application:: ELISA, WB
Molecular Weight:: 75 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGLLTPLHLEGLVQFQDVSFAYPNRPDVLVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKPLPQYEHRYLHRQVAAVGQEPQVFGRSLQENIAYGLTQKPTMEEITAAAVKSGAHSFISGLPQGYDTEVDEAGSQLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESPERYSRSVLLITQHLSLVEQADHILFLEGGAIREGGTHQQLMEKKGCYWAMVQAPADAPE
Uniprot:: Q03518
Synonyms:: ABC transporter, MHC 1;ABC17;ABCB2;antigen peptide transporter 1;APT1;ATP-binding cassette sub-family B member 2;ATP-binding cassette, sub-family B (MDR/TAP), member 2;D6S114E;peptide supply factor 1;peptide transporter involved in antigen processing 1;peptide transporter PSF1;peptide transporter TAP1;PSF-1;PSF1;really interesting new gene 4 protein;RING4;TAP1*0102N;TAP1N;transporter 1 ATP-binding cassette sub-family B;transporter 1, ATP-binding cassette, sub-family B (MDR/TAP);transporter associated with antigen processing;transporter, ATP-binding cassette, major histocompatibility complex, 1
Extra Details:: The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The protein encoded by this gene is involved in the pumping of degraded cytosolic peptides across the endoplasmic reticulum into the membrane-bound compartment where class I molecules assemble. Mutations in this gene may be associated with ankylosing spondylitis, insulin-dependent diabetes mellitus, and celiac disease. Two transcript variants encoding different isoforms have been found for this gene.

Shipping Conditions:: Blue Ice