A22766
IL-1 alpha Rabbit monoclonal antibody
Size
POA
- SKU:
- A22766
- Additional Names:
- IL-1 alpha|Il-1a
- Application:
- ELISA, WB
- Molecular Weight:
- 20-25 kDa/31 kDa
- Species Reactivity:
- Mouse
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- SAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS
- Uniprot:
- P01582
- Synonyms:
- hematopoietin-1;Il;IL-1 alpha;IL-1A;IL1;IL1-ALPHA;IL1F1;interleukin-1 alpha;preinterleukin 1 alpha;pro-interleukin-1-alpha
- Extra Details:
- Enables cytokine activity and interleukin-1 receptor binding activity. Involved in positive regulation of angiogenesis and positive regulation of vascular endothelial growth factor production. Acts upstream of or within several processes, including cell surface receptor signaling pathway; connective tissue replacement involved in inflammatory response wound healing; and positive regulation of cytokine production. Located in cytoplasm and extracellular space. Is expressed in several structures, including alimentary system; brain; hemolymphoid system gland; reproductive system; and respiratory system. Human ortholog(s) of this gene implicated in several diseases, including Fabry disease; Schnitzler syndrome; autoimmune disease (multiple); hematologic cancer (multiple); and lung disease (multiple). Orthologous to human IL1A (interleukin 1 alpha).
- Shipping Conditions:
- Blue Ice