A22765
SLC6A2 Rabbit monoclonal antibody

Size
POA
- SKU:
- A22765
- Additional Names:
- NAT1|NET|NET1|SLC6A2|SLC6A5
- Application:
- ELISA, WB
- Molecular Weight:
- 69kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MLLARMNPQVQPENNGADTGPEQPLRARKTAELLVVKERNGVQCLLAPRDGDAQPRETWGKKIDFLLSVV
- Uniprot:
- P23975
- Synonyms:
- NAT1;NET;NET1;neurotransmitter transporter;norepinephrine transporter;SLC6A5;sodium-dependent noradrenaline transporter;solute carrier family 6 (neurotransmitter transporter, noradrenalin), member 2;solute carrier family 6 (neurotransmitter transporter), member 2;Solute carrier family 6 member 2;solute carrier family 6 member 5
- Extra Details:
- This gene encodes a member of the sodium:neurotransmitter symporter family. This member is a multi-pass membrane protein, which is responsible for reuptake of norepinephrine into presynaptic nerve terminals and is a regulator of norepinephrine homeostasis. Mutations in this gene cause orthostatic intolerance, a syndrome characterized by lightheadedness, fatigue, altered mentation and syncope. Alternatively spliced transcript variants encoding different isoforms have been identified in this gene.
- Shipping Conditions:
- Blue Ice

