SLC6A2 Rabbit monoclonal antibody

Size

POA

SKU:: A22765
Additional Names:: NAT1|NET|NET1|SLC6A2|SLC6A5
Application:: ELISA, WB
Molecular Weight:: 69kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MLLARMNPQVQPENNGADTGPEQPLRARKTAELLVVKERNGVQCLLAPRDGDAQPRETWGKKIDFLLSVV
Uniprot:: P23975
Synonyms:: NAT1;NET;NET1;neurotransmitter transporter;norepinephrine transporter;SLC6A5;sodium-dependent noradrenaline transporter;solute carrier family 6 (neurotransmitter transporter, noradrenalin), member 2;solute carrier family 6 (neurotransmitter transporter), member 2;Solute carrier family 6 member 2;solute carrier family 6 member 5
Extra Details:: This gene encodes a member of the sodium:neurotransmitter symporter family. This member is a multi-pass membrane protein, which is responsible for reuptake of norepinephrine into presynaptic nerve terminals and is a regulator of norepinephrine homeostasis. Mutations in this gene cause orthostatic intolerance, a syndrome characterized by lightheadedness, fatigue, altered mentation and syncope. Alternatively spliced transcript variants encoding different isoforms have been identified in this gene.