STK39 Rabbit monoclonal antibody

Size

POA

SKU:: A2275
Additional Names:: DCHT|PASK|SPAK|Ste 20 related kinase|STK39
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 68kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: SQEKSRRVKEENPEIAVSASTIPEQIQSLSVHDSQGPPNANEDYREASSCAVNLVLRLRNSRKELNDIRFEFTPGRDTADGVSQELFSAGLVDGHDVVIVAANLQKIVDDPKALKTLTFKLASGCDGSEIPDEVKLIGFAQLSVS
Uniprot:: Q9UEW8
Synonyms:: DCHT;PASK;proline-alanine-rich STE20-related kinase;serine threonine kinase 39 (STE20/SPS1 homolog, yeast);serine/threonine-protein kinase 39;small intestine SPAK-like kinase;SPAK;ste-20-related kinase;Ste20-like protein kinase;STE20/SPS1 homolog;STE20/SPS1-related proline-alanine-rich protein kinase
Extra Details:: This gene encodes a serine/threonine kinase that is thought to function in the cellular stress response pathway. The kinase is activated in response to hypotonic stress, leading to phosphorylation of several cation-chloride-coupled cotransporters. The catalytically active kinase specifically activates the p38 MAP kinase pathway, and its interaction with p38 decreases upon cellular stress, suggesting that this kinase may serve as an intermediate in the response to cellular stress.