[KO Validated] Smad5 Rabbit monoclonal antibody

Size

POA

SKU:: A22749
Additional Names:: d5|DWFC|JV5-1|MADH5
Application:: ELISA, WB
Molecular Weight:: 60 kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: PLSPNSPYPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQPMDTSNNMIPQIMPSISSRDV
Uniprot:: Q99717
Synonyms:: DWFC;JV5-1;MAD, mothers against decapentaplegic homolog 5;MADH5;mothers against decapentaplegic homolog 5;mothers against decapentaplegic, drosophila, homolog of, 5;SMA- and MAD-related protein 5;SMAD family member 5;SMAD, mothers against DPP homolog 5
Extra Details:: The protein encoded by this gene is involved in the transforming growth factor beta signaling pathway that results in an inhibition of the proliferation of hematopoietic progenitor cells. The encoded protein is activated by bone morphogenetic proteins type 1 receptor kinase, and may be involved in cancer. Alternative splicing results in multiple transcript variants.