A22740
IFN-beta Rabbit monoclonal antibody

Size
POA
- SKU:
- A22740
- Additional Names:
- If1da1|Ifb|IFN-beta|IFNB
- Application:
- ELISA, WB
- Molecular Weight:
- 63kDa (C-hFc&His taged Active Recombinant Mouse IFN-beta Protein)
- Species Reactivity:
- Mouse
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MNNRWILHAAFLLCFSTTALSINYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIVVRLLDELHQQTVFLKTVLEEKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNFQN
- Uniprot:
- P01575
- Synonyms:
- fibroblast interferon;If;If1da1;IFB;IFF;IFN-b;IFN-beta;IFNB;interferon 1da1;interferon beta;interferon-beta;interferon, beta 1, fibroblast
- Extra Details:
- Enables cytokine activity and type I interferon receptor binding activity. Involved in B cell proliferation; cellular response to virus; and type I interferon signaling pathway. Acts upstream of or within several processes, including cellular response to organic cyclic compound; defense response to other organism; and negative regulation of osteoclast differentiation. Located in extracellular space. Is expressed in embryo and liver. Human ortholog(s) of this gene implicated in COVID-19. Orthologous to human IFNB1 (interferon beta 1).
- Shipping Conditions:
- Blue Ice

