A22710
NFATC3 Rabbit monoclonal antibody
Size
POA
- SKU:
- A22710
- Additional Names:
- n339260|NF-AT4c|NFAT4|NFATC3|NFATX
- Application:
- ELISA, WB, IF
- Molecular Weight:
- 150kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- SSIPFHSSNSGSTGHLLAHTPHSVHTLPHLQSMGYHCSNTGQRSLSSPVADQITGQPSSQLQPITYGPSHSGSATTASPAASHPLASSPLSGPPSPQLQPMPYQSPSSGTASSPSPATRMHSGQHSTQAQSTGQGGLSAPSSLICHSLCDPASFPPDGATVSIKPEPEDREPNFATIGLQDITLDDVNEIIGRDMSQISVSQGAGVSRQAPLPSPESLDLGRSDGL
- Uniprot:
- Q12968
- Synonyms:
- NF-AT4c;NF-ATc3;NFAT4;NFATX;nuclear factor of activated T-cells, cytoplasmic 3;nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3;T cell transcription factor NFAT4;T-cell transcription factor NFAT4
- Extra Details:
- The product of this gene is a member of the nuclear factors of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation and an inducible nuclear component. Other members of this family participate to form this complex also. The product of this gene plays a role in the regulation of gene expression in T cells and immature thymocytes. Several transcript variants encoding distinct isoforms have been identified for this gene.
- Shipping Conditions:
- Blue Ice