COL4A6 Rabbit polyclonal antibody

Size

£152.00

SKU:: A22673
Additional Names:: COL4A6|CXDELq22.3|DELXq22.3|DFNX6
Application:: ELISA, WB
Molecular Weight:: 170-185kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: SQAIAVHSQDITIPQCPLGWRSLWIGYSFLMHTAAGAEGGGQSLVSPGSCLEDFRATPFIECSGARGTCHYFANKYSFWLTTVEERQQFGELPVSETLKAGQLHTRVSRCQVCMKSL
Uniprot:: Q14031
Synonyms:: collagen alpha-6(IV) chain;collagen IV, alpha-6 polypeptide;collagen of basement membrane, alpha-6;collagen, type IV, alpha 6;CXDELq22.3;DELXq22.3;DFNX6;dJ889N15.4 (Collagen Alpha 6(IV))
Extra Details:: This gene encodes one of the six subunits of type IV collagen, the major structural component of basement membranes. Like the other members of the type IV collagen gene family, this gene is organized in a head-to-head conformation with another type IV collagen gene, alpha 5 type IV collagen, so that the gene pair shares a common promoter. Deletions in the alpha 5 gene that extend into the alpha 6 gene result in diffuse leiomyomatosis accompanying the X-linked Alport syndrome caused by the deletion in the alpha 5 gene. Alternative splicing results in multiple transcript variants encoding different isoforms.