LIN28A Rabbit PolymAb[R]

Size

POA

SKU:: A22648PM
Additional Names:: CSDD1|LIN-28|lin-28A|LIN28|ZCCHC1
Application:: ELISA, WB
Molecular Weight:: 28 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: SAKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHS
Uniprot:: Q9H9Z2
Synonyms:: CSDD1;LIN-28;lin-28A;LIN28;protein lin-28 homolog A;RNA-binding protein LIN-28;ZCCHC1;zinc finger CCHC domain-containing protein 1;zinc finger, CCHC domain containing 1
Extra Details:: This gene encodes a LIN-28 family RNA-binding protein that acts as a posttranscriptional regulator of genes involved in developmental timing and self-renewal in embryonic stem cells. The encoded protein functions through direct interaction with target mRNAs and by disrupting the maturation of certain miRNAs involved in embryonic development. This protein prevents the terminal processing of the LET7 family of microRNAs which are major regulators of cellular growth and differentiation. Aberrant expression of this gene is associated with cancer progression in multiple tissues.