CD79a Rabbit PolymAb[R]

Size

POA

SKU:: A22645PM
Additional Names:: IGA|IGAlpha|MB-1|MB1
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 45-55kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LGPGCQALWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNRIITAEGIILLFCAVVPGTLLLFRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLNIGDVQLEKP
Uniprot:: P11912
Synonyms:: B-cell antigen receptor complex-associated protein alpha chain;CD79a antigen (immunoglobulin-associated alpha);CD79a molecule, immunoglobulin-associated alpha;ig-alpha;IGA;MB-1;MB-1 membrane glycoprotein;membrane-bound immunoglobulin-associated protein;surface IgM-associated protein
Extra Details:: The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-alpha protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described.