POU4F1Rabbit polyclonal antibody

Size

£152.00

SKU:: A22620
Additional Names:: ATITHS|brn-3A|BRN3A|Oct-T1|RDC-1
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 55kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MMSMNSKQPHFAMHPTLPEHKYPSLHSSSEAIRRACLPTPPLQSNLFASLDETLLARAEALAAVDIAVSQGKSHPFKPDATYHTMNSVPCTSTSTVPLAH
Uniprot:: Q01851
Synonyms:: ATITHS;brain-specific homeobox/POU domain protein 3A;brn-3A;BRN3A;homeobox/POU domain protein RDC-1;Oct-T1;POU domain, class 4, transcription factor 1;RDC-1
Extra Details:: This gene encodes a member of the POU-IV class of neural transcription factors. This protein is expressed in a subset of retinal ganglion cells and may be involved in the developing sensory nervous system. This protein may also promote the growth of cervical tumors. A translocation of this gene is associated with some adult acute myeloid leukemias.