BAP31 Rabbit monoclonal antibody

Size

POA

SKU:: A2259
Additional Names:: 6C6-AG|BAP31|CDM|DDCH|DELXQ28|DXS1357E|MICRODELXq28
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 28kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: RNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQ
Uniprot:: P51572
Synonyms:: 6C6-AG;6C6-AG tumor-associated antigen;B-cell receptor-associated protein 31;BAP31;BCR-associated protein Bap31;CDM;DDCH;DXS1357E;p28;p28 Bap31;Protein CDM
Extra Details:: This gene encodes a member of the B-cell receptor associated protein 31 superfamily. The encoded protein is a multi-pass transmembrane protein of the endoplasmic reticulum that is involved in the anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi and in caspase 8-mediated apoptosis. Microdeletions in this gene are associated with contiguous ABCD1/DXS1375E deletion syndrome (CADDS), a neonatal disorder. Alternative splicing of this gene results in multiple transcript variants. Two related pseudogenes have been identified on chromosome 16.