A22554
ELAPOR1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A22554
- Additional Names:
- EIG121|ELAPOR1|KIAA1324
- Application:
- ELISA, WB
- Molecular Weight:
- 140kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LWAGTAFQVTQGTGPELHACKESEYHYEYTACDSTGSRWRVAVPHTPGLCTSLPDPVKGTECSFSCNAGEFLDMKDQSCKPCAEGRYSLGTGIRFDEWDEL
- Uniprot:
- Q6UXG2
- Synonyms:
- EIG121;endosome/lysosome-associated apoptosis and autophagy regulator 1;estrogen-induced gene 121 protein;KIAA1324;maba1
- Extra Details:
- Expression of this gene is induced by estrogen and the encoded protein has been characterized as a transmembrane protein. The encoded protein has been found in to correlate with survival in certain carcinomas (PMID: 21102415) and may be important for cellular response to stress (PMID: 21072319). Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice