A22547
Human TNFRSF11A Rabbit polyclonal antibody

Size
POA
- SKU:
- A22547
- Additional Names:
- CD265|FEO|Human TNFRSF11A|LOH18CR1|ODFR|OFE|OPTB7|OSTS|PDB2|RANK|TRANCE-R|TRANCER
- Application:
- ELISA, WB
- Molecular Weight:
- 100kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- IAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARKPPNEPHVYLP
- Uniprot:
- Q9Y6Q6
- Synonyms:
- CD265;familial expansile osteolysis;FEO;LOH18CR1;loss of heterozygosity, 18, chromosomal region 1;ODFR;OFE;OPTB7;osteoclast differentiation factor receptor;OSTS;Paget disease of bone 2;PDB2;RANK;receptor activator of NF-KB;receptor activator of nuclear factor-kappa B;TRANCE receptor;TRANCE-R;TRANCER;tumor necrosis factor receptor superfamily member 11A;tumor necrosis factor receptor superfamily, member 11a, NFKB activator
- Extra Details:
- The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptors can interact with various TRAF family proteins, through which this receptor induces the activation of NF-kappa B and MAPK8/JNK. This receptor and its ligand are important regulators of the interaction between T cells and dendritic cells. This receptor is also an essential mediator for osteoclast and lymph node development. Mutations at this locus have been associated with familial expansile osteolysis, autosomal recessive osteopetrosis, and Paget disease of bone. Alternatively spliced transcript variants have been described for this locus.
- Shipping Conditions:
- Blue Ice

