A22543
E2A Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A22543
- Additional Names:
- AGM8|AGM8A|AGM8B|bHLHb21|E2A|E47|ITF1|p75|TCF-3|VDIR
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 75kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- DGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAGATAAASEIKREEKEDEENTSAADHSEEEKKELKAPR
- Uniprot:
- P15923
- Synonyms:
- AGM8;bHLHb21;class B basic helix-loop-helix protein 21;E2A;E2A-HLF fusion transcript protein;E47;helix-loop-helix protein HE47;Immunoglobulin enhancer-binding factor E12/E47;immunoglobulin transcription factor 1;ITF1;kappa-E2-binding factor;negative vitamin D response element-binding protein;NOL1-TCF3 fusion;p75;TCF-3;Transcription factor 3;transcription factor 3 (E2A immunoglobulin enhancer binding factors E12/E47);transcription factor 3 variant 3;transcription factor E2-alpha;transcription factor ITF-1;VDIR;VDR interacting repressor;vitamin D receptor-interacting repressor
- Extra Details:
- This gene encodes a member of the E protein (class I) family of helix-loop-helix transcription factors. E proteins activate transcription by binding to regulatory E-box sequences on target genes as heterodimers or homodimers, and are inhibited by heterodimerization with inhibitor of DNA-binding (class IV) helix-loop-helix proteins. E proteins play a critical role in lymphopoiesis, and the encoded protein is required for B and T lymphocyte development. Deletion of this gene or diminished activity of the encoded protein may play a role in lymphoid malignancies. This gene is also involved in several chromosomal translocations that are associated with lymphoid malignancies including pre-B-cell acute lymphoblastic leukemia (t(1;19), with PBX1), childhood leukemia (t(19;19), with TFPT) and acute leukemia (t(12;19), with ZNF384). Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the short arm of chromosome 9.
- Shipping Conditions:
- Blue Ice








