ALDH1A1 Rabbit PolymAb[R]

Size

POA

SKU:: A22531PM
Additional Names:: ALDC|ALDH-E1|ALDH1|ALDH11|HEL-9|HEL-S-53e|HEL12|PUMB1|RALDH1
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 55kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: VGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQ
Uniprot:: P00352
Synonyms:: acetaldehyde dehydrogenase 1;ALDC;aldehyde dehydrogenase 1, soluble;Aldehyde dehydrogenase family 1 member A1;Aldehyde dehydrogenase, cytosolic;aldehyde dehydrogenase, liver cytosolic;ALDH class 1;ALDH-E1;ALDH1;ALDH11;ALHDII;epididymis luminal protein 12;epididymis luminal protein 9;epididymis secretory sperm binding protein Li 53e;HEL-9;HEL-S-53e;HEL12;PUMB1;RALDH 1;RALDH1;retinal dehydrogenase 1;retinaldehyde dehydrogenase 1
Extra Details:: The protein encoded by this gene belongs to the aldehyde dehydrogenase family. Aldehyde dehydrogenase is the next enzyme after alcohol dehydrogenase in the major pathway of alcohol metabolism. There are two major aldehyde dehydrogenase isozymes in the liver, cytosolic and mitochondrial, which are encoded by distinct genes, and can be distinguished by their electrophoretic mobility, kinetic properties, and subcellular localization. This gene encodes the cytosolic isozyme. Studies in mice show that through its role in retinol metabolism, this gene may also be involved in the regulation of the metabolic responses to high-fat diet.

Shipping Conditions:: Blue Ice