Prolyl hydroxylase PHD1 (EGLN2) Rabbit polyclonal antibody

Size

£152.00

SKU:: A2252
Additional Names:: EIT-6|EIT6|HIF-PH1|HIFPH1|HPH-1|HPH-3|PHD1|Prolyl hydroxylase PHD1 (EGLN2)
Application:: ELISA, WB, IP
Molecular Weight:: 43kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: AALGGRVLAEVEALKRGGRLRDGQLVSQRAIPPRSIRGDQIAWVEGHEPGCRSIGALMAHVDAVIRHCAGRLGSYVINGRTKAMVACYPGNGLGYVRHVDNPHGDGRCITCIYYLNQNWDVKVHGGLLQIFPEGRPVVANIEPLFDRLLIFWSDRRNPHEVKPAYATRYAITVWYFDAKERAAAKDKYQLASGQKGVQVPVSQPPTPT
Uniprot:: Q96KS0
Synonyms:: egl nine homolog 2;EIT-6;EIT6;estrogen-induced tag 6;HIF-PH1;HIF-prolyl hydroxylase 1;HIFPH1;HPH-1;HPH-3;hypoxia-inducible factor prolyl hydroxylase 1;PHD1;prolyl hydroxylase domain-containing protein 1;prolyl hydroxylase EGLN2
Extra Details:: The hypoxia inducible factor (HIF) is a transcriptional complex that is involved in oxygen homeostasis. At normal oxygen levels, the alpha subunit of HIF is targeted for degration by prolyl hydroxylation. This gene encodes an enzyme responsible for this post-translational modification. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the upstream RAB4B (RAB4B, member RAS oncogene family) gene.