ABflo[R] 488 Rabbit anti-Human CD317/BST2 monoclonal antibody

Size

POA

SKU:: A22517
Additional Names:: CD317|HM1.24|TETHERIN
Application:: Flow Cytometry
Molecular Weight:: Refer to figures
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: NSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDS
Uniprot:: Q10589
Synonyms:: antiviral factor tetherin;bone marrow stromal antigen 2;BST-2;CD317;HM1.24;HM1.24 antigen;NPC-A-7;TETHERIN
Extra Details:: Bone marrow stromal cells are involved in the growth and development of B-cells. The specific function of the protein encoded by the bone marrow stromal cell antigen 2 is undetermined; however, this protein may play a role in pre-B-cell growth and in rheumatoid arthritis.