Folate Binding Protein(FBP) / FOLR1 Rabbit PolymAb[R]

Size

POA

SKU:: A22481PM
Additional Names:: FBP|FOLR|FRalpha|NCFTD
Application:: ELISA, WB
Molecular Weight:: 38kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHF
Uniprot:: P15328
Synonyms:: adult folate-binding protein;FBP;folate binding protein;Folate receptor 1;folate receptor 1 (adult);folate receptor alpha;folate receptor, adult;FOLR;FR-alpha;FRalpha;KB cells FBP;NCFTD;ovarian tumor-associated antigen MOv18
Extra Details:: The protein encoded by this gene is a member of the folate receptor family. Members of this gene family bind folic acid and its reduced derivatives, and transport 5-methyltetrahydrofolate into cells. This gene product is a secreted protein that either anchors to membranes via a glycosyl-phosphatidylinositol linkage or exists in a soluble form. Mutations in this gene have been associated with neurodegeneration due to cerebral folate transport deficiency. Due to the presence of two promoters, multiple transcription start sites, and alternative splicing, multiple transcript variants encoding the same protein have been found for this gene.