[KD Validated] Pin1 Rabbit monoclonal antibody

Size

POA

SKU:: A22470
Additional Names:: [KD Validated] Pin1|DOD|UBL5
Application:: ELISA, WB
Molecular Weight:: 18kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Uniprot:: Q13526
Synonyms:: DOD;peptidyl-prolyl cis-trans isomerase NIMA-interacting 1;Peptidyl-prolyl cis-trans isomerase Pin1;PPIase Pin1;protein (peptidyl-prolyl cis/trans isomerase) NIMA-interacting 1;protein interacting with never in mitosis A1;rotamase Pin1;UBL5
Extra Details:: Peptidyl-prolyl cis/trans isomerases (PPIases) catalyze the cis/trans isomerization of peptidyl-prolyl peptide bonds. This gene encodes one of the PPIases, which specifically binds to phosphorylated ser/thr-pro motifs to catalytically regulate the post-phosphorylation conformation of its substrates. The conformational regulation catalyzed by this PPIase has a profound impact on key proteins involved in the regulation of cell growth, genotoxic and other stress responses, the immune response, induction and maintenance of pluripotency, germ cell development, neuronal differentiation, and survival. This enzyme also plays a key role in the pathogenesis of Alzheimer's disease and many cancers. Multiple alternatively spliced transcript variants have been found for this gene.

Shipping Conditions:: Blue Ice