A22468
ATP6AP1 Rabbit monoclonal antibody

Size
POA
- SKU:
- A22468
- Additional Names:
- 16A|Ac45|ATP6AP1|ATP6IP1|ATP6S1|CF2|VATPS1|XAP-3|XAP3
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 63kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MMAAMATARVRMGPRCAQALWRMPWLPVFLSLAAAAAAAAAEQQVPLVLWSSDRDLWAPAADTHEGHITSDLQLSTYLDPALELGPRNVLLFLQDKLSIE
- Uniprot:
- Q15904
- Synonyms:
- 16A;Ac45;ATP6IP1;ATP6S1;ATPase, H+ transporting, lysosomal (vacuolar proton pump), subunit 1;ATPase, H+ transporting, lysosomal accessory protein 1;ATPase, H+ transporting, lysosomal interacting protein 1;CF2;epididymis secretory sperm binding protein;H-ATPase subunit;protein XAP-3;V-ATPase Ac45 subunit;V-ATPase S1 accessory protein;V-ATPase subunit S1;V-type proton ATPase subunit S1;vacuolar ATPase subunit S1;vacuolar proton pump subunit S1;VATPS1;X-associated protein 3;XAP-3;XAP3
- Extra Details:
- This gene encodes a component of a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. Vacuolar ATPase (V-ATPase) is comprised of a cytosolic V1 (site of the ATP catalytic site) and a transmembrane V0 domain. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, and receptor-mediated endocytosis. The encoded protein of this gene may assist in the V-ATPase-mediated acidification of neuroendocrine secretory granules. This protein may also play a role in early development.
- Shipping Conditions:
- Blue Ice





