A22379
CD83 Rabbit monoclonal antibody
Size
POA
- SKU:
- A22379
- Additional Names:
- BL11|CD83|HB15
- Application:
- ELISA, WB
- Molecular Weight:
- 23-65 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRA
- Uniprot:
- Q01151
- Synonyms:
- B-cell activation protein;BL11;CD83 antigen;CD83 antigen (activated B lymphocytes, immunoglobulin superfamily);cell surface protein HB15;cell-surface glycoprotein;HB15;hCD83
- Extra Details:
- The protein encoded by this gene is a single-pass type I membrane protein and member of the immunoglobulin superfamily of receptors. The encoded protein may be involved in the regulation of antigen presentation. A soluble form of this protein can bind to dendritic cells and inhibit their maturation. Three transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice