ABflo[R] 647 Rabbit anti-Human CD225/IFITM1 monoclonal antibody

Size

POA

SKU:: A22311
Additional Names:: 9-27|CD225|DSPA2a|IFI17|LEU13
Application:: Flow Cytometry
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MHKEEHEVAVLGPPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYAS
Uniprot:: P13164
Synonyms:: 9-27;CD225;dispanin subfamily A member 2a;DSPA2a;IFI17;interferon-induced protein 17;interferon-induced transmembrane protein 1;interferon-inducible protein 9-27;leu-13 antigen;LEU13
Extra Details:: Interferon-induced transmembrane (IFITM) proteins are a family of interferon induced antiviral proteins. The family contains five members, including IFITM1, IFITM2 and IFITM3 that belong to the CD225 superfamily. The protein encoded by this gene restricts cellular entry by diverse viral pathogens, such as influenza A virus, Ebola virus and Sars-CoV-2.