ABflo[R] 488 Rabbit anti-Human CD51/ITGAV monoclonal antibody

Size

POA

SKU:: A22298
Additional Names:: CD51|MSK8|VNRA|VTNR
Application:: Flow Cytometry
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: SLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET
Uniprot:: P06756
Synonyms:: antigen identified by monoclonal antibody L230;CD51;integrin alpha-V;integrin alphaVbeta3;integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51);MSK8;Vitronectin receptor;vitronectin receptor subunit alpha;VNRA;VTNR
Extra Details:: The product of this gene belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane proteins composed of an alpha subunit and a beta subunit that function in cell surface adhesion and signaling. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha V subunit. This subunit associates with beta 1, beta 3, beta 5, beta 6 and beta 8 subunits. The heterodimer consisting of alpha V and beta 3 subunits is also known as the vitronectin receptor. This integrin may regulate angiogenesis and cancer progression. Alternative splicing results in multiple transcript variants. Note that the integrin alpha 5 and integrin alpha V subunits are encoded by distinct genes.

Shipping Conditions:: Blue Ice