A22293
PAX3 Rabbit monoclonal antibody

Size
POA
- SKU:
- A22293
- Additional Names:
- CDHS|HUP2|PAX-3|PAX3|WS1|WS3
- Application:
- ELISA, WB
- Molecular Weight:
- 53kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- SSSAYCLPSTRHGFSSYTDSFVPPSGPSNPMNPTIGNGLSPQVMGLLTNHGGVPHQPQTDYALSPLTGGLEPTTTVSASCSQRLDHMKSLDSLPTSQSYCP
- Uniprot:
- P23760
- Synonyms:
- CDHS;HUP2;paired box homeotic gene 3;paired box protein Pax-3;paired domain gene 3;paired domain gene HuP2;transcriptional factor PAX3;WS1;WS3
- Extra Details:
- This gene is a member of the paired box (PAX) family of transcription factors. Members of the PAX family typically contain a paired box domain and a paired-type homeodomain. These genes play critical roles during fetal development. Mutations in paired box gene 3 are associated with Waardenburg syndrome, craniofacial-deafness-hand syndrome, and alveolar rhabdomyosarcoma. The translocation t(2;13)(q35;q14), which represents a fusion between PAX3 and the forkhead gene, is a frequent finding in alveolar rhabdomyosarcoma. Alternative splicing results in transcripts encoding isoforms with different C-termini.
- Shipping Conditions:
- Blue Ice

