A22284
IL4 Rabbit monoclonal antibody
Size
POA
- SKU:
- A22284
- Additional Names:
- BSF-1|Il-4|IL4
- Application:
- ELISA, WB
- Molecular Weight:
- 16kDa/18kDa (Recombinant Protein)
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS
- Uniprot:
- P07750
- Synonyms:
- B cell growth factor 1;B_cell stimulatory factor 1;B-cell growth factor 1;B-cell IgG differentiation factor;B-cell stimulatory factor 1;BCGF-1;BCGF1;binetrakin;BSF-1;BSF1;IGG1 induction factor;Il;IL-4;interleukin 4 variant 2;interleukin-4;lymphocyte stimulatory factor 1;pitrakinra
- Extra Details:
- Enables cytokine activity. Involved in several processes, including innate immune response in mucosa; negative regulation of white fat cell proliferation; and regulation of gene expression. Acts upstream of or within several processes, including T-helper cell differentiation; positive regulation of macromolecule metabolic process; and regulation of leukocyte activation. Located in external side of plasma membrane and extracellular space. Is expressed in several structures, including brain; colon; hemolymphoid system; liver; and placenta. Used to study Sjogren's syndrome; atopic dermatitis; and type 1 diabetes mellitus. Human ortholog(s) of this gene implicated in several diseases, including asthma (multiple); autoimmune disease (multiple); hepatitis B; hepatitis C; and pancreatic cancer (multiple). Orthologous to human IL4 (interleukin 4).
- Shipping Conditions:
- Blue Ice