S100A7/Psoriasin Rabbit monoclonal antibody

Size

POA

SKU:: A22271
Additional Names:: PSOR1|S100A7/Psoriasin|S100A7c
Application:: ELISA, WB, IHC-P
Molecular Weight:: 12 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant fusion protein containing a sequence corresponding to amino acids 2-101 of human S100A7/Psoriasin (NP_002954.2).
Formulation:: Unmodified
Sequence:: SNTQAERSIIGMIDMFHKYTRRDDKIEKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ
Uniprot:: P31151
Synonyms:: protein S100-A7;PSOR1;Psoriasin;psoriasin 1;S100 calcium-binding protein A7;S100A7c
Extra Details:: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein differs from the other S100 proteins of known structure in its lack of calcium binding ability in one EF-hand at the N-terminus. The protein is overexpressed in hyperproliferative skin diseases, exhibits antimicrobial activities against bacteria and induces immunomodulatory activities.