APRR7 Rabbit polyclonal antibody

Size

POA

SKU:: A22255
Additional Names:: APRR7|F9G14_120|F9G14.120|pseudo-response regulator 7
Application:: ELISA, WB
Molecular Weight:: 80kDa
Species Reactivity:: Plant
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Plant
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ENENGSIGLNASDGSSDGSGAQSSWTKKAVDVDDSPRAVSLWDRVDSTCAQVVHSNPEFPSNQLVAPPAEKETQEHDDKFEDVTMGRDLEISIRRNCDLALEPK
Synonyms:: APRR7;AT5G02810;F9G14_120;F9G14.120;pseudo-response regulator 7
Extra Details:: PRR7 and PRR9 are partially redundant essential components of a temperature-sensitive circadian system. CCA1 and LHY had a positive effect on PRR7 expression levels. Acts as transcriptional repressor of CCA1 and LHY.