HNRNPUL1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A22236
Additional Names:: E1B-AP5|E1BAP5|HNRNPUL1|HNRPUL1
Application:: ELISA, WB
Molecular Weight:: 96 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: TLVAIDTYNCDLHFKVARDRSSGYPLTIEGFAYLWSGARASYGVRRGRVCFEMKINEEISVKHLPSTEPDPHVVRIGWSLDSCSTQLGEEPFSYGYGGTGKKSTNSRFENYGDKFAENDVIGCFADFECGNDVELSFTKNGKWMGIAFRIQKEALGGQALYPHVLVKNCAVEFNFGQRAEPYCSVLPGFTFIQHLPLSERIR
Uniprot:: Q9BUJ2
Synonyms:: adenovirus early region 1B-associated protein 5;E1B 55kDa associated protein 5;E1B-55 kDa-associated protein 5;E1B-AP5;E1BAP5;heterogeneous nuclear ribonucleoprotein U-like protein 1;HNRPUL1
Extra Details:: This gene encodes a nuclear RNA-binding protein of the heterogeneous nuclear ribonucleoprotein (hnRNP) family. This protein binds specifically to adenovirus early-1B-55kDa oncoprotein. It may play an important role in nucleocytoplasmic RNA transport, and its function is modulated by early-1B-55kDa in adenovirus-infected cells.