Semaphorin 3A Rabbit monoclonal antibody

Size

POA

SKU:: A22204
Additional Names:: coll-1|COLL1|HH16|Hsema-I|Hsema-III|SEMA1|SEMAD|SEMAIII|SEMAL|Semaphorin 3A|SemD
Application:: ELISA, WB
Molecular Weight:: 89kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ERIIYGVENSSTFLECSPKSQRALVYWQFQRRNEERKEEIRVDDHIIRTDQGLLLRSLQQKDSGNYLCHAVEHGFIQTLLKVTLEVIDTEHLEELLHKDDDGDGSKTKEMSNSMTPSQKVWYRDFMQLINHPNLNTMDEFCEQVWKRDRKQRRQRPGHTPGNSNKWKHLQENKKGRNRRTHEFERAPRSV
Uniprot:: Q14563
Synonyms:: coll-1;COLL1;collapsin 1;HH16;Hsema-I;Hsema-III;sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3A;SEMA1;SEMAD;SEMAIII;SEMAL;semaphorin D;semaphorin III;semaphorin L;semaphorin-3A;SemD
Extra Details:: This gene is a member of the semaphorin family and encodes a protein with an Ig-like C2-type (immunoglobulin-like) domain, a PSI domain and a Sema domain. This secreted protein can function as either a chemorepulsive agent, inhibiting axonal outgrowth, or as a chemoattractive agent, stimulating the growth of apical dendrites. In both cases, the protein is vital for normal neuronal pattern development. Increased expression of this protein is associated with schizophrenia and is seen in a variety of human tumor cell lines. Also, aberrant release of this protein is associated with the progression of Alzheimer's disease.

Shipping Conditions:: Blue Ice