ABflo[R] 647 Rabbit anti-Human CD7 monoclonal antibody

Size

POA

SKU:: A22194
Additional Names:: GP40|LEU-9|Tp40|TP41
Application:: Flow Cytometry
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP
Uniprot:: P09564
Synonyms:: CD7 antigen (p41);GP40;LEU-9;p41 protein;T-cell antigen CD7;T-cell leukemia antigen;T-cell surface antigen Leu-9;Tp40;TP41
Extra Details:: This gene encodes a transmembrane protein which is a member of the immunoglobulin superfamily. This protein is found on thymocytes and mature T cells. It plays an essential role in T-cell interactions and also in T-cell/B-cell interaction during early lymphoid development.