A22172
PCK1 Rabbit monoclonal antibody

Size
POA
- SKU:
- A22172
- Additional Names:
- PCK1|PCKDC|PEPCK-C|PEPCK1|PEPCKC
- Application:
- ELISA, WB
- Molecular Weight:
- 69kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- GKFLWPGFGENSRVLEWMFNRIDGKASTKLTPIGYIPKEDALNLKGLGHINMMELFSISKEFWEKEVEDIEKYLEDQVNADLPCEIEREILALKQRISQM
- Uniprot:
- P35558
- Synonyms:
- PCKDC;PEP carboxykinase;PEPCK-C;PEPCK1;PEPCKC;phosphoenolpyruvate carboxykinase 1 (soluble);phosphoenolpyruvate carboxykinase, cytosolic;phosphoenolpyruvate carboxykinase, cytosolic [GTP];phosphoenolpyruvate carboxylase;phosphopyruvate carboxylase;serine-protein kinase PCK1
- Extra Details:
- This gene is a main control point for the regulation of gluconeogenesis. The cytosolic enzyme encoded by this gene, along with GTP, catalyzes the formation of phosphoenolpyruvate from oxaloacetate, with the release of carbon dioxide and GDP. The expression of this gene can be regulated by insulin, glucocorticoids, glucagon, cAMP, and diet. Defects in this gene are a cause of cytosolic phosphoenolpyruvate carboxykinase deficiency. A mitochondrial isozyme of the encoded protein also has been characterized.
- Shipping Conditions:
- Blue Ice



