CD69 Rabbit monoclonal antibody

Size

POA

SKU:: A22171
Additional Names:: AIM|BL-AC/P26|CD69|CLEC2C|EA1|GP32/28|MLR-3
Application:: ELISA, WB
Molecular Weight:: 25-45kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: SVGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK
Uniprot:: Q07108
Synonyms:: Activation inducer molecule;activation inducer molecule (AIM/CD69);AIM;BL-AC/P26;C-type lectin domain family 2 member C;C-type lectin domain family 2, member C;CD69 antigen (p60, early T-cell activation antigen);CLEC2C;EA1;early activation antigen CD69;early lymphocyte activation antigen;early T-cell activation antigen p60;GP32/28;leukocyte surface antigen Leu-23;MLR-3
Extra Details:: This gene encodes a member of the calcium dependent lectin superfamily of type II transmembrane receptors. Expression of the encoded protein is induced upon activation of T lymphocytes, and may play a role in proliferation. Furthermore, the protein may act to transmit signals in natural killer cells and platelets.