A2215
ALIX / PDCD6IP Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A2215
- Additional Names:
- AIP1|ALIX|ALIX / PDCD6IP|DRIP4|HP95|MCPH29
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 105 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNLDNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDIS
- Uniprot:
- Q8WUM4
- Synonyms:
- AIP1;ALG-2 interacting protein 1;ALG-2-interacting protein 1;ALG-2-interacting protein X;ALIX;apoptosis-linked gene 2-interacting protein X;dopamine receptor interacting protein 4;DRIP4;HP95;PDCD6-interacting protein;programmed cell death 6-interacting protein
- Extra Details:
- This gene encodes a protein that functions within the ESCRT pathway in the abscission stage of cytokinesis, in intralumenal endosomal vesicle formation, and in enveloped virus budding. Studies using mouse cells have shown that overexpression of this protein can block apoptosis. In addition, the product of this gene binds to the product of the PDCD6 gene, a protein required for apoptosis, in a calcium-dependent manner. This gene product also binds to endophilins, proteins that regulate membrane shape during endocytosis. Overexpression of this gene product and endophilins results in cytoplasmic vacuolization, which may be partly responsible for the protection against cell death. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. Related pseudogenes have been identified on chromosome 15.
- Shipping Conditions:
- Blue Ice





