A22121
pan-Trk Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A22121
- Application:
- ELISA, WB
- Molecular Weight:
- 120-140kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Sequence:
- ESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVLG
- Uniprot:
- P04629, Q16288, Q16620
- Synonyms:
- BDNF-tropomyosine receptor kinase B;BDNF/NT-3 growth factors receptor;DEE58;EIEE58;ETS related protein-neurotrophic receptor tyrosine kinase fusion protein;ETV6-NTRK3 fusion;gp140trk;GP145-TrkB;GP145-TrkC;gp145(trkC);high affinity nerve growth factor receptor;MTC;Neurotrophic tyrosine kinase receptor type 1;neurotrophic tyrosine kinase receptor type 2;Neurotrophic tyrosine kinase receptor type 3;neurotrophic tyrosine kinase, receptor, type 1;neurotrophic tyrosine kinase, receptor, type 3;NT-3 growth factor receptor;OBHD;Oncogene TRK;p140-TrkA;TRK;Trk-A;trk-B;TRK1;TRK1-transforming tyrosine kinase protein;TRKA;TRKB;TrkB tyrosine kinase;TRKC;TrkC tyrosine kinase;tropomyosin-related kinase A;tropomyosin-related kinase B;Tyrosine kinase receptor;tyrosine kinase receptor A;tyrosine kinase receptor B;tyrosine kinase receptor C
- Extra Details:
- Neurotrophic tyrosine kinase (NTRK) is a family of receptor tyrosine kinase.The NTRK gene family contains three members, NTRK1, NTRK2 and NTRK3, which produce TRKA, TRKB and TRKC proteins, respectively.TRK kinases leads to cell differentiation and may play important roles in normal neural functions.Rearrangements in the NTRK genes can result in two genes fusing together and producing altered TRK proteins, which can lead to uncontrolled growth of cancer cells. Neurotrophic tyrosine receptor kinase (NTRK) gene fusions are an actionable biomarker for cancer therapy and can be found in over 25 different types of cancer.
- Shipping Conditions:
- Blue Ice

