A22119
RGL2 Rabbit polyclonal antibody
Size
POA
- SKU:
- A22119
- Additional Names:
- RGA-like 2|RGL2|T21P5_13|T21P5.13
- Application:
- ELISA, WB
- Molecular Weight:
- 60kDa
- Species Reactivity:
- Plant
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Plant
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- SNMDDELLAVLGYKVRSSEMAEVAQKLEQLEMVLSNDDVGSTVLNDSVHYNPSDLSNWVESMLSELNNPASSDLDTTRSCVDRSEYDLRAIPGLSAFPKEEEVFDEEASSKRIRLGS
- Uniprot:
- Q8GXW1
- Synonyms:
- AT3G03450;GDS-related protein;GRAS family protein 15;HKE1.5;KE1.5;RAB2L;ral guanine nucleotide dissociation stimulator-like 2;ralGDS-like 2;ralGDS-like factor;ras-associated protein RAB2L;RGA-like 2;RGA-like protein 2;Scarecrow-like protein 19;T21P5_13;T21P5.13
- Extra Details:
- Encodes a DELLA protein, a member of the GRAS superfamily of putative transcription factors. DELLA proteins restrain the cell proliferation and expansion that drives plant growth. Negative regulator of the response to GA in controlling seed germination. GA triggers the degradation of RGL2 protein in a process blocked by both proteasome inhibitors and serine/threonine phosphatase inhibitors. The protein undergoes degradation in response to GA via the 26S proteasome. RGL2 may be involved in reducing ROS accumulation in response to stress by up-regulating the transcription of superoxide dismutases. Rapidly degraded in response to GA. Regulates GA-promoted seed germination. Involved in flower and fruit development.
- Shipping Conditions:
- Blue Ice