NANOG Rabbit polyclonal antibody

Size

£152.00

SKU:: A22115
Additional Names:: 2410002E02Rik|ecat4|ENK|NANOG|Stm1
Application:: ELISA, WB
Molecular Weight:: 29-42kDa
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LKTSNGLIQKGSAPVEYPSIHCSYPQGYLVNASGSLSMWGSQTWTNPTWSSQTWTNPTWNNQTWTNPTWSSQAWTAQSWNGQPWNAAPLHNFGEDFLQPYVQLQQNFSASDLEVNLEATRESHAHFSTPQALELFLNYSVTPPGEI
Uniprot:: Q80Z64
Synonyms:: 2410002E02Rik;early embryo specific expression NK family;early embryo specific expression NK-type homeobox protein;ecat;ecat4;EN;ENK;ES cell-associated protein 4;homeobox protein NANOG;homeobox transcription factor Nanog
Extra Details:: The protein encoded by this gene is a DNA binding homeobox transcription factor involved in embryonic stem (ES) cell proliferation, renewal, and pluripotency. The encoded protein can block ES cell differentiation and can also autorepress its own expression in differentiating cells. Several transcript variants encoding different isoforms have been found for this gene.