ANKRD1 Rabbit monoclonal antibody

Size

POA

SKU:: A22096
Additional Names:: ALRP|ANKRD1|bA320F15.2|C-193|CARP|CVARP|MCARP
Application:: ELISA, WB
Molecular Weight:: 40kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MMVLKVEELVTGKKNGNGEAGEFLPEDFRDGEYEAAVTLEKQEDLKTLLAHPVTLGEQQWKSEKQREAELKKKKLEQRSKLENLEDLEIIIQLKKRKKYRKTKVPVVKEPEPEIITEPVDVPTFLKAALE
Uniprot:: Q15327
Synonyms:: ALRP;ankyrin repeat domain 1 (cardiac muscle);ankyrin repeat domain-containing protein 1;bA320F15.2;C-193;cardiac ankyrin repeat protein;CARP;CVARP;cytokine-inducible gene C-193 protein;cytokine-inducible nuclear protein;epididymis secretory sperm binding protein;liver ankyrin repeat domain 1;MCARP
Extra Details:: The protein encoded by this gene is localized to the nucleus of endothelial cells and is induced by IL-1 and TNF-alpha stimulation. Studies in rat cardiomyocytes suggest that this gene functions as a transcription factor. Interactions between this protein and the sarcomeric proteins myopalladin and titin suggest that it may also be involved in the myofibrillar stretch-sensor system.