SOX11 Rabbit monoclonal antibody

Size

POA

SKU:: A22052
Additional Names:: CSS9|IDDMOH|MRD27|SOX11
Application:: ELISA, WB
Molecular Weight:: 60kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MVQQAESLEAESNLPREALDTEEGEFMACSPVALDESDPDWCKTASGHIKRPMNAFMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIR
Uniprot:: P35716
Synonyms:: CSS9;MRD27;SRY (sex-determining region Y)-box 11;SRY-box 11;SRY-related HMG-box gene 11;transcription factor SOX-11
Extra Details:: This intronless gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The protein may function in the developing nervous system and play a role in tumorigenesis.