A22039
[KD Validated] Ajuba Rabbit monoclonal antibody

Size
POA
- SKU:
- A22039
- Additional Names:
- [KD Validated] Ajuba|JUB
- Application:
- ELISA, WB, IP
- Molecular Weight:
- 55kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- PSAYPELHAALDRLYAQRPAGFGCQESRHSYPPALGSPGALAGAGVGAAGPLERRGAQPGRHSVTGYGDCAVGARYQDELTALLRLTVGT
- Uniprot:
- Q96IF1
- Synonyms:
- JUB;jub, ajuba homolog;LIM domain-containing protein ajuba
- Extra Details:
- Enables alpha-catenin binding activity and transcription corepressor activity. Involved in several processes, including negative regulation of hippo signaling; positive regulation of gene silencing by miRNA; and regulation of cellular response to hypoxia. Acts upstream of or within gene silencing by miRNA and positive regulation of protein-containing complex assembly. Located in several cellular components, including Golgi apparatus; P-body; and nucleoplasm.
- Shipping Conditions:
- Blue Ice
![[KD Validated] Ajuba Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A22039/A22039_1.jpg)
![[KD Validated] Ajuba Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A22039/A22039_2.jpg)
![[KD Validated] Ajuba Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A22039/A22039_3.jpg)
![[KD Validated] Ajuba Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A22039/A22039_ARC54979-01_WB_01.jpg)
![[KD Validated] Ajuba Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A22039/A22039_ARC54979-01_KO-WB_01.jpg)
![[KD Validated] Ajuba Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A22039/A22039_ARC54979-01_IP_01.jpg)