A22037
CD132/IL-2 R gamma Rabbit monoclonal antibody
Size
POA
- SKU:
- A22037
- Additional Names:
- CD132|CD132/IL-2 R gamma|CIDX|IL-2RG|IMD4|P64|SCIDX|SCIDX1
- Application:
- ELISA, WB
- Molecular Weight:
- 50-70kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- TSKENPFLFALEAVVISVGSMGLIISLLCVYFWLERTMPRIPTLKNLEDLVTEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGASP
- Uniprot:
- P31785
- Synonyms:
- CD132;CD132 antigen;CIDX;common cytokine receptor gamma chain;cytokine receptor common subunit gamma;gammaC;IL-2 receptor subunit gamma;IL-2R subunit gamma;IL-2RG;IMD4;interleukin 2 receptor, gamma;Interleukin-2 receptor subunit gamma;nonfunctional common cytokine receptor gamma chain;P64;SCIDX;SCIDX1
- Extra Details:
- The protein encoded by this gene is an important signaling component of many interleukin receptors, including those of interleukin -2, -4, -7 and -21, and is thus referred to as the common gamma chain. Mutations in this gene cause X-linked severe combined immunodeficiency (XSCID), as well as X-linked combined immunodeficiency (XCID), a less severe immunodeficiency disorder.
- Shipping Conditions:
- Blue Ice