[KD Validated] MIF Rabbit polyclonal antibody

Size

POA

SKU:: A22014
Additional Names:: GIF|GLIF|IF|MMIF
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 12kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
Uniprot:: P14174
Synonyms:: epididymis secretory sperm binding protein;GIF;GLIF;Glycosylation-inhibiting factor;L-dopachrome isomerase;L-dopachrome tautomerase;macrophage migration inhibitory factor;macrophage migration inhibitory factor (glycosylation-inhibiting factor);MMIF;phenylpyruvate tautomerase
Extra Details:: This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways.