A22013
PDLIM5 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A22013
- Additional Names:
- ENH|ENH1|L9|LIM|PDLIM5
- Application:
- ELISA, WB
- Molecular Weight:
- 64kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- ADNTKKANNSQEPSPQLASSVASTRSMPESLDSPTSGRPGVTSLTAAAAFKPVGSTGVIKSPSWQRPNQGVPSTGRISNSATYSGSVAPANSALGQTQPSD
- Uniprot:
- Q96HC4
- Synonyms:
- ENH;ENH1;enigma homolog;enigma-like LIM domain protein;enigma-like PDZ and LIM domains protein;L9;LIM;PDZ and LIM domain protein 5
- Extra Details:
- This gene encodes a member of a family of proteins that possess a 100-amino acid PDZ domain at the N terminus and one to three LIM domains at the C-terminus. This family member functions as a scaffold protein that tethers protein kinases to the Z-disk in striated muscles. It is thought to function in cardiomyocyte expansion and in restraining postsynaptic growth of excitatory synapses. Alternative splicing of this gene results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice