[KD Validated] ISG15 Rabbit polyclonal antibody

Size

POA

SKU:: A21995
Additional Names:: [KD Validated] ISG15|G1P2|hUCRP|IFI15|IMD38|IP17|UCRP
Application:: ELISA, WB
Molecular Weight:: 15kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS
Uniprot:: P05161
Synonyms:: G1P2;hUCRP;IFI15;IMD38;Interferon-induced 15 kDa protein;Interferon-induced 17 kDa protein;interferon-induced 17-kDa/15-kDa protein;interferon-stimulated protein, 15 kDa;interferon, alpha-inducible protein (clone IFI-15K);IP17;ubiquitin cross-reactive protein;ubiquitin-like protein ISG15;UCRP
Extra Details:: The protein encoded by this gene is a ubiquitin-like protein that is conjugated to intracellular target proteins upon activation by interferon-alpha and interferon-beta. Several functions have been ascribed to the encoded protein, including chemotactic activity towards neutrophils, direction of ligated target proteins to intermediate filaments, cell-to-cell signaling, and antiviral activity during viral infections. While conjugates of this protein have been found to be noncovalently attached to intermediate filaments, this protein is sometimes secreted.

Shipping Conditions:: Blue Ice